Antibodies

View as table Download

Rabbit Polyclonal Anti-STX19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STX19 Antibody: synthetic peptide directed towards the N terminal of human STX19. Synthetic peptide located within the following region: LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR

Rabbit Polyclonal Anti-STX19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein