Rabbit Polyclonal Anti-T Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-T Antibody: synthetic peptide directed towards the N terminal of human T. Synthetic peptide located within the following region: SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL |
Rabbit Polyclonal Anti-T Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-T Antibody: synthetic peptide directed towards the middle region of human T. Synthetic peptide located within the following region: TSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS |
Germany
Japan
United Kingdom
China