Antibodies

View as table Download

Rabbit polyclonal anti-ZMY11 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZMY11.

Rabbit Polyclonal Anti-ZMYND11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the middle region of human ZMYND11. Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV

Rabbit Polyclonal Anti-ZMYND11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the N terminal of human ZMYND11. Synthetic peptide located within the following region: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT

Rabbit Polyclonal Anti-ZMYND11 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZMYND11

ZMYND11 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZMYND11

ZMYND11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 278-567 of human ZMYND11 (NP_997644.2).
Modifications Unmodified