Rabbit polyclonal anti-CASZ1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Drosophila, Chimpanzee and Macaque |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein. |
Rabbit Polyclonal Anti-CASZ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA |
Rabbit Polyclonal Anti-CASZ1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CASZ1 |
Germany
Japan
United Kingdom
China