Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC4A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC4A2 Antibody: synthetic peptide directed towards the N terminal of human SLC4A2. Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI

SLC4A2 / AE2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC4A2 / AE2 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Rabbit, Pig (100%); Monkey, Bovine, Guinea pig (94%); Elephant (89%); Bat, Opossum (83%).