Antibodies

Jump to Filters
View as table Download
Dapl1 Rabbit Polyclonal Antibody
TA331715

USD 375.00

5 Days

Rabbit Polyclonal Anti-Dapl1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Dapl1 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dapl1. Synthetic peptide located within the following region: MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSA