Antibodies

View as table Download

Rabbit Polyclonal antibody to Cytokeratin 10 (keratin 10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 73 and 284 of Cytokeratin 10

Rabbit Polyclonal Anti-KRT10 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KRT10 antibody: synthetic peptide directed towards the N terminal of human KRT10. Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Rabbit Polyclonal Anti-Keratin 10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 10 Antibody: A synthesized peptide derived from human Keratin 10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10