Antibodies

Jump to Filters
View as table Download
Probable hydrolase PNKD (PNKD) Rabbit Polyclonal Antibody
TA335592

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pnkd Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pnkd Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK
PNKD Rabbit Polyclonal Antibody
TA365809

USD 380.00

4 Weeks

PNKD rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PNKD
PNKD Rabbit Polyclonal Antibody
TA370151

USD 380.00

4 Weeks

PNKD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PNKD