Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-POU4F3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-POU4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR |
Goat Anti-POU4F3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EAAYREKNSKPE, from the internal region of the protein sequence according to NP_002691.1. |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Pou4f3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
POU4F3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). |
| Modifications | Unmodified |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody,clone OTI4D12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody,clone OTI4D12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- POU4F3
Reactivities
- Mouse