Antibodies

View as table Download

Goat Polyclonal Antibody against SIM1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGDRYRTEQYQS, from the internal region of the protein sequence according to NP_005059.2.

Rabbit Polyclonal Anti-SIM1 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIM1 Antibody is: synthetic peptide directed towards the middle region of Human SIM1. Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR