Antibodies

View as table Download

Rabbit Polyclonal Anti-Ap3b1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ap3b1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM

AP3B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AP3B1

AP3B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AP3B1