Antibodies

Jump to Filters
View as table Download
SH3GL2 Rabbit Polyclonal Antibody
TA342207

USD 375.00

5 Days

Rabbit polyclonal Anti-SH3GL2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the N terminal of human SH3GL2. Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
SH3GL2 Rabbit Polyclonal Antibody
TA365772

USD 380.00

4 Weeks

SH3GL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SH3GL2
SH3GL2 Rabbit Polyclonal Antibody
TA370111

USD 380.00

4 Weeks

SH3GL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SH3GL2