Antibodies

Jump to Filters
View as table Download
ABHD4 Rabbit Polyclonal Antibody
TA344709

USD 475.00

5 Days

Rabbit Polyclonal Anti-ABHD4 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abhd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Abhd4. Synthetic peptide located within the following region: DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD
ABHD4 Rabbit Polyclonal Antibody
TA373155

USD 275.00

3 Weeks

ABHD4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 223-342 of human ABHD4 (NP_071343.2).
Modifications Unmodified