Antibodies

Jump to Filters
View as table Download
HOXC6 Rabbit Polyclonal Antibody
TA329236

USD 375.00

5 Days

Rabbit Polyclonal anti-Hoxc6 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hoxc6 antibody is: synthetic peptide directed towards the middle region of Rat Hoxc6. Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ