Antibodies

View as table Download

Rabbit polyclonal OCT6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OCT6.

Goat Polyclonal Antibody against OCT6 (aa192-204)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HEDGHEAQLEPSP, from the internal region of the protein sequence according to NP_002690.3.

Rabbit Polyclonal Anti-Pou3f1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pou3f1 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f1. Synthetic peptide located within the following region: CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD

Anti-POU3F1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 13 amino acids of human POU class 3 homeobox 1

POU3F1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POU3F1.