Goat Polyclonal Antibody against RXRA
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Goat Polyclonal Antibody against RXRA
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF |
RXRα Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRα (NP_002948.1). |
Modifications | Unmodified |