Antibodies

Jump to Filters
View as table Download
TGF beta induced factor 2 (TGIF2) Goat Polyclonal Antibody
TA303055

USD 375.00

In Stock

Goat Polyclonal Antibody against TGIF2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EMELQKQQDP, from the internal region of the protein sequence according to NP_068581.1.
Tgif2 Rabbit Polyclonal Antibody
TA345340

USD 475.00

5 Days

Rabbit Polyclonal Anti-RGD1564927 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-RGD1564927 antibody is: synthetic peptide directed towards the C-terminal region of Rat RGD1564927. Synthetic peptide located within the following region: PPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDPAPPLLHTPLPLV
TGF beta induced factor 2 (TGIF2) Rabbit Polyclonal Antibody
TA308314

USD 415.00

5 Days

Rabbit polyclonal antibody to TGF beta induced factor 2 (TGFB-induced factor homeobox 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 161 and 237 of TGF beta induced factor 2