Antibodies

Jump to Filters
View as table Download
STARS (ABRA) (C-term) Rabbit Polyclonal Antibody
AP50033PU-N

USD 450.00

2 Weeks

STARS (ABRA) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human ABRA
STARS (ABRA) Rabbit Polyclonal Antibody
TA340326

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABRA antibody: synthetic peptide directed towards the middle region of human ABRA. Synthetic peptide located within the following region: QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
Abra Rabbit Polyclonal Antibody
TA357063

USD 360.00

5 Days

Abra Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated