Antibodies

View as table Download

Goat Polyclonal Antibody against SNX26

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SWSLHSEGQTRSYC, from the C Terminus of the protein sequence according to NP_443180.2.

Goat Polyclonal Antibody against SNX26 (N-terminal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ARSTDSLDGPGE-C, from the N Terminus of the protein sequence according to NP_443180.2.

Rabbit Polyclonal Anti-ARHGAP33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARHGAP33 Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP33. Synthetic peptide located within the following region: PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW