Antibodies

Jump to Filters
View as table Download
B4GALT3 Rabbit Polyclonal Antibody
TA372907

USD 380.00

4 Weeks

B4GALT3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human B4GALT3
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 345.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
B4GALT3 Rabbit Polyclonal Antibody
TA338207

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the N terminal of human B4GALT3. Synthetic peptide located within the following region: PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
B4GALT3 Rabbit Polyclonal Antibody
TA338208

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the middle region of human B4GALT3. Synthetic peptide located within the following region: MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF808622

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B4galt3 Rabbit Polyclonal Antibody
TA356555

USD 360.00

5 Days

B4galt3 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
B4GALT3 Rabbit Polyclonal Antibody
TA373901

USD 220.00

3 Weeks

B4GALT3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human B4GALT3 (NP_003770.1).
Modifications Unmodified
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
TA808622

USD 379.00

In Stock

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B4GALT3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA808622AM

USD 420.00

4 Weeks

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
B4GALT3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA808622BM

USD 420.00

4 Weeks

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]
TA808622S

USD 159.00

2 Days

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated