B4GAT1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human B4GAT1 |
B4GAT1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human B4GAT1 |
Rabbit Polyclonal Anti-B3gnt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B3gnt1 antibody is: synthetic peptide directed towards the middle region of Mouse B3gnt1. Synthetic peptide located within the following region: RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL |
B4GAT1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human B4GAT1 |