Antibodies

Jump to Filters
View as table Download
CHST8 Rabbit Polyclonal Antibody
TA315729

USD 345.00

In Stock

Rabbit polyclonal anti-CHST8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST8.
CHST8 (Center) Rabbit Polyclonal Antibody
AP50915PU-N

USD 450.00

2 Weeks

CHST8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 226-255 amino acids from the Central region of human CHST8
CHST8 Rabbit Polyclonal Antibody
TA338606

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHST8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST8 antibody: synthetic peptide directed towards the middle region of human CHST8. Synthetic peptide located within the following region: GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST
CHST8 Rabbit Polyclonal Antibody
TA359607

USD 360.00

5 Days

CHST8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N region of human CHST8