Antibodies

Jump to Filters
View as table Download
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347354

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA312091

USD 345.00

4 Weeks

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347919

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA312090

USD 345.00

In Stock

Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V).
Modifications Phospho-specific
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA334202

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA354288

USD 355.00

5 Days

Rabbit anti Claudin 5 Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
CF500843

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA323846

USD 345.00

In Stock

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA323847

USD 345.00

In Stock

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA374854

USD 220.00

3 Weeks

CLDN5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-303 of human CLDN5 (NP_001124333.1).
Modifications Unmodified
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA384012

USD 380.00

4 Weeks

Claudin 5 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 5. AA range:169-218
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA500843

USD 379.00

In Stock

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA500843S

USD 159.00

In Stock

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".