Antibodies

Jump to Filters
View as table Download
COTL1 Mouse Monoclonal Antibody [Clone ID: AT1D6]
AM50092PU-N

USD 340.00

2 Weeks

COTL1 mouse monoclonal antibody, clone AT1D6, Purified

Applications ELISA, WB
Reactivities Human
COTL1 Mouse Monoclonal Antibody [Clone ID: AT1D6]
AM50092PU-S

USD 230.00

2 Weeks

COTL1 mouse monoclonal antibody, clone AT1D6, Purified

Applications ELISA, WB
Reactivities Human
COTL1 Rabbit Polyclonal Antibody
TA333728

USD 375.00

5 Days

Rabbit Polyclonal Anti-COTL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COTL1 Antibody: synthetic peptide directed towards the N terminal of human COTL1. Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
COTL1 Rabbit Polyclonal Antibody
TA375010

USD 220.00

3 Weeks

COTL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1).
Modifications Unmodified