Antibodies

Jump to Filters
View as table Download
DEFB119 Goat Polyclonal Antibody
TA309520

USD 270.00

5 Days

Goat Polyclonal Antibody against Defensin, beta 119

Reactivities Expected from seq similarity: Human
Immunogen Peptide with sequence C-EENTDWSYEKQWPR, from the C Terminus of the protein sequence according to NP_695021.2; NP_775689.1; NP_697018.1.
DEFB119 Rabbit Polyclonal Antibody
TA331614

USD 375.00

5 Days

Rabbit Polyclonal Anti-DEFB119 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DEFB119 Antibody is: synthetic peptide directed towards the N-terminal region of Human DEFB119. Synthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC