Antibodies

View as table Download

Rabbit Polyclonal Anti-FANCL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FANCL Antibody: synthetic peptide directed towards the middle region of human FANCL. Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Goat Anti-FANCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QNLKDVLEIDFP, from the internal region of the protein sequence according to NP_001108108.1; NP_060532.2.

FANCL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human FANCL (NP_060532.2).
Modifications Unmodified

Rabbit polyclonal anti-FANCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FANCL

Rabbit polyclonal anti-FANCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FANCL