Antibodies

Jump to Filters
View as table Download
Glutathione Transferase zeta 1 (GSTZ1) Rabbit Polyclonal Antibody
TA330970

USD 310.00

5 Days

Rabbit polyclonal Anti-GSTZ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
Glutathione Transferase zeta 1 (GSTZ1) Rabbit Polyclonal Antibody
TA361387

USD 360.00

5 Days

GSTZ1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GSTZ1
GSTZ1 Rabbit Polyclonal Antibody
TA365980

USD 380.00

4 Weeks

GSTZ1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GSTZ1
GSTZ1 Rabbit Polyclonal Antibody
TA370332

USD 380.00

4 Weeks

GSTZ1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GSTZ1
Glutathione Transferase zeta 1 (GSTZ1) Rabbit Polyclonal Antibody
TA376844

USD 220.00

3 Weeks

GSTZ1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-216 of human GSTZ1 (NP_665877.1).
Modifications Unmodified
Glutathione Transferase zeta 1 (GSTZ1) Mouse Monoclonal Antibody [Clone ID: OTI6A10]
TA810616S

USD 159.00

2 Days

GSTZ1 mouse monoclonal antibody,clone OTI6A10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".