Antibodies

View as table Download

Rabbit Polyclonal Anti-HAGHL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HAGHL Antibody is: synthetic peptide directed towards the C-terminal region of Human HAGHL. Synthetic peptide located within the following region: PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA

Carrier-free (BSA/glycerol-free) HAGHL mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HAGHL mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HAGHL mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

HAGHL mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated