Rabbit Polyclonal Anti-MRM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRM1 antibody: synthetic peptide directed towards the C terminal of human MRM1. Synthetic peptide located within the following region: GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ |
Rabbit Polyclonal Anti-MRM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRM1 antibody: synthetic peptide directed towards the C terminal of human MRM1. Synthetic peptide located within the following region: LVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSI |
MRM1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRM1 |
MRM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human MRM1 (NP_079140.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
