Antibodies

View as table Download

Rabbit polyclonal anti-OR2B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2B2.

Rabbit Polyclonal Anti-OR2B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2B2 antibody: synthetic peptide directed towards the C terminal of human OR2B2. Synthetic peptide located within the following region: IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY

OR2B2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2B2