Antibodies

View as table Download

Rabbit Polyclonal Anti-OR2H1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2H1 antibody: synthetic peptide directed towards the C terminal of human OR2H1. Synthetic peptide located within the following region: IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL

OR2H1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2H1

OR2H1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C region of human OR2H1