Antibodies

Jump to Filters
View as table Download
OR6C68 Rabbit Polyclonal Antibody
TA316463

USD 345.00

In Stock

Rabbit polyclonal anti-OR6C68 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR6C68.
OR6C68 Rabbit Polyclonal Antibody
TA336169

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR6C68 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6C68 Antibody: synthetic peptide directed towards the N terminal of human OR6C68. Synthetic peptide located within the following region: MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA