Antibodies

Jump to Filters
View as table Download
OS9 Rabbit Polyclonal Antibody
TA301503

USD 424.00

In Stock

Rabbit Polyclonal Antibody against OS-9

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of isoform 1 of the human protein (within residues 300-400). [Swiss-Prot# Q13438]
OS9 Rabbit Polyclonal Antibody
TA335671

USD 375.00

5 Days

Rabbit Polyclonal Anti-OS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OS9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OS9. Synthetic peptide located within the following region: LKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF
OS9 Rabbit Polyclonal Antibody
TA350253

USD 345.00

In Stock

Rabbit Polyclonal Anti-OS9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human OS9
OS9 Rabbit Polyclonal Antibody
TA364906

USD 380.00

4 Weeks

OS9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human OS9
OS9 Rabbit Polyclonal Antibody
TA379505

USD 220.00

3 Weeks

OS9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 353-612 of human OS9 (NP_001017956.1).
Modifications Unmodified