Antibodies

View as table Download

Rabbit Polyclonal Anti-OSGEP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the middle region of human OSGEP. Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE

Rabbit Polyclonal Anti-OSGEP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the N terminal of human OSGEP. Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Rabbit polyclonal antibody to OSGEP (O-sialoglycoprotein endopeptidase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 140 and 335 of OSGEP (Uniprot ID#Q9NPF4)

Carrier-free (BSA/glycerol-free) OSGEP mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) OSGEP mouse monoclonal antibody, clone OTI9E3 (formerly 9E3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

OSGEP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human OSGEP (NP_060277.1).
Modifications Unmodified

OSGEP mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

OSGEP mouse monoclonal antibody, clone OTI8B3 (formerly 8B3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

OSGEP mouse monoclonal antibody, clone OTI8B3 (formerly 8B3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

OSGEP mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

OSGEP mouse monoclonal antibody, clone OTI9E3 (formerly 9E3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

OSGEP mouse monoclonal antibody, clone OTI9E3 (formerly 9E3), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

OSGEP mouse monoclonal antibody, clone OTI9E3 (formerly 9E3), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

OSGEP mouse monoclonal antibody, clone OTI9E3 (formerly 9E3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated