Antibodies

View as table Download

Rabbit Polyclonal Anti-C3orf39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the N terminal of human C3orf39. Synthetic peptide located within the following region: MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALR

Rabbit Polyclonal Anti-C3orf39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39. Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

POMGNT2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2).
Modifications Unmodified