Antibodies

View as table Download

Rabbit Polyclonal Anti-PRDM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM8 antibody: synthetic peptide directed towards the N terminal of human PRDM8. Synthetic peptide located within the following region: MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTS

Rabbit Polyclonal Anti-PRDM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM8 antibody: synthetic peptide directed towards the middle region of human PRDM8. Synthetic peptide located within the following region: DLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSH

PRDM8 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 74-102 amino acids from the N-terminal region of human PRDM8

Rabbit Polyclonal Anti-PRDM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM8 antibody: synthetic peptide directed towards the N terminal of human PRDM8. Synthetic peptide located within the following region: PENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPYIFRVDTSAANGSSEG