Antibodies

Jump to Filters
View as table Download
PUS1 (C-term) Rabbit Polyclonal Antibody
AP53521PU-N

USD 450.00

2 Weeks

PUS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human PUS1
Pus1 Rabbit Polyclonal Antibody
TA342334

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pus1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pus1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL
PUS1 Rabbit Polyclonal Antibody
TA342335

USD 375.00

5 Days

Rabbit Polyclonal Anti-PUS1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PUS1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PTIVSTERDERSMAQWLNTLPIHNFSGTALGAADTGAKVPSSLEGSEGDG
PUS1 Rabbit Polyclonal Antibody
TA357942

USD 360.00

5 Days

PUS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
PUS1 Rabbit Polyclonal Antibody
TA380572

USD 220.00

3 Weeks

PUS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2).
Modifications Unmodified