Rabbit Polyclonal antibody to SNX18 (sorting nexin 18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 566 and 628 of SNX18 (Uniprot ID#Q96RF0) |
Rabbit Polyclonal antibody to SNX18 (sorting nexin 18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 566 and 628 of SNX18 (Uniprot ID#Q96RF0) |
Goat Anti-SNX18 / SNAG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KVQRVPLMTVLSF, from the C Terminus of the protein sequence according to NP_443102.2. |
Rabbit Polyclonal Anti-SNX22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SNX22 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNX22. Synthetic peptide located within the following region: LEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALH |
Rabbit Polyclonal Anti-SNX18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNAG1 antibody: synthetic peptide directed towards the N terminal of human SNAG1. Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD |
SNAG1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SNAG1 |
SNAG1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SNAG1 |
SNX18 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 445-624 of human SNX18 (NP_001096045.1). |
Modifications | Unmodified |