Antibodies

View as table Download

SRP72 (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 126~156 amino acids from the Center region of Human SRP72

Rabbit Polyclonal Anti-SRP72 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP72 antibody: synthetic peptide directed towards the middle region of human SRP72. Synthetic peptide located within the following region: GDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRG