Antibodies

View as table Download

Rabbit polyclonal Anti-SSX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSX2 antibody: synthetic peptide directed towards the C terminal of human SSX2. Synthetic peptide located within the following region: HRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRE

SSX2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of uman SSX2

Rabbit Polyclonal Anti-SSX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSX2 antibody is: synthetic peptide directed towards the middle region of Human SSX2

Carrier-free (BSA/glycerol-free) SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SSX2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SSX2

SSX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human SSX2 (NP_783629.1).
Modifications Unmodified

Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), Biotinylated

Applications IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), HRP conjugated

Applications IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), Biotinylated

Applications IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), HRP conjugated

Applications IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".