Rabbit Polyclonal Anti-STON1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STON1 Antibody: A synthesized peptide derived from human STON1 |
Rabbit Polyclonal Anti-STON1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STON1 Antibody: A synthesized peptide derived from human STON1 |
Rabbit Polyclonal anti-SALF antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-SALF antibody: synthetic peptide directed towards the C terminal of human SALF. Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD |