Antibodies

Jump to Filters
View as table Download
TBC1D14 (Center) Rabbit Polyclonal Antibody
AP54164PU-N

USD 450.00

2 Weeks

TBC1D14 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 259-286 amino acids from the Central region of human TBC14
TBC1D14 Rabbit Polyclonal Antibody
TA335907

USD 375.00

5 Days

Rabbit Polyclonal Anti-TBC1D14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBC1D14 Antibody: synthetic peptide directed towards the N terminal of human TBC1D14. Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL