Antibodies

Jump to Filters
View as table Download
ZNF706 Rabbit Polyclonal Antibody
TA331929

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF706 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF706 Antibody: synthetic peptide directed towards the N terminal of human ZNF706. Synthetic peptide located within the following region: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD
ZNF706 Rabbit Polyclonal Antibody
TA329913

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF706 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF706 antibody: synthetic peptide directed towards the N terminal of human ZNF706. Synthetic peptide located within the following region: ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDP