Antibodies

Jump to Filters
View as table Download
A1CF (C-term) Rabbit Polyclonal Antibody
AP50047PU-N

USD 450.00

2 Weeks

A1CF (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 397-427 amino acids from the C-terminal region of human ACF
A1CF Rabbit Polyclonal Antibody
TA343985

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
A1CF Rabbit Polyclonal Antibody
TA343814

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA
A1CF Rabbit Polyclonal Antibody
TA343984

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-A1CF antibody is: synthetic peptide directed towards the N-terminal region of Human A1CF. Synthetic peptide located within the following region: LGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGW
A1CF Rabbit Polyclonal Antibody
TA373103

USD 275.00

3 Weeks

A1CF Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2).
Modifications Unmodified