Antibodies

Jump to Filters
View as table Download
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA314800

USD 345.00

In Stock

Rabbit polyclonal anti-ABCC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC3.
MRP3 (ABCC3) (Center) Rabbit Polyclonal Antibody
AP50015PU-N

USD 512.00

2 Weeks

MRP3 (ABCC3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 906-933 amino acids from the Central region of human ABCC3.
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA332100

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC3 Antibody: synthetic peptide directed towards the middle region of human ABCC3. Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA322825

USD 345.00

In Stock

Anti-ABCC3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 881-894 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 3
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA373138

USD 410.00

3 Weeks

ABCC3 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA890097

USD 407.00

In Stock

Rabbit Polyclonal anti-ABCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC3
MRP3 (ABCC3) Rabbit Polyclonal Antibody
TA890097S

USD 159.00

In Stock

Rabbit Polyclonal anti-ABCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC3