Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against ABCC8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ABCC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Mouse Monoclonal Anti-SUR1 Antibody
| Reactivities | Hamster, Mouse, Rat |
| Conjugation | Unconjugated |
ABCC8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human ABCC8 (NP_000343.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ABCC8