Antibodies

Jump to Filters
View as table Download
FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody
TA331704

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI
Abhd17a Rabbit Polyclonal Antibody
TA363520

USD 360.00

5 Days

ABHD17A Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of rat FAM108A