Antibodies

Jump to Filters
View as table Download
FAM108C1 (ABHD17C) (Center) Rabbit Polyclonal Antibody
AP51518PU-N

USD 450.00

2 Weeks

FAM108C1 (ABHD17C) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 99-130 amino acids from the Central region of human FAM108C1
FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody
TA335493

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD17C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM108C1 Antibody is: synthetic peptide directed towards the middle region of Human FAM108C1. Synthetic peptide located within the following region: GSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENI