Rabbit Polyclonal Anti-C4orf29 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-C4orf29 antibody is: synthetic peptide directed towards the N-terminal region of Human C4orf29. Synthetic peptide located within the following region: WRRRTLMARPMIKEARMASLLLENPYYGCRKPKDQVRSSLKNVSDLFVMG |
Rabbit Polyclonal Anti-C4orf29 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-C4orf29 antibody is: synthetic peptide directed towards the C-terminal region of Human C4orf29. Synthetic peptide located within the following region: GYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPS |
Germany
Japan
United Kingdom
China