Rabbit Polyclonal Anti-ABHD5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK |
Rabbit Polyclonal Anti-ABHD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5. Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL |
Goat Polyclonal Antibody against CGI58 / ABHD5
| Applications | WB |
| Reactivities | Human.Mouse, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-FPERPDLADQDR, from the internal region of the protein sequence according to NP_057090.2. |
Anti-ABHD5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5 |
Germany
Japan
United Kingdom
China
